Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POU2F1 Rabbit Polyclonal Antibody (Biotin)

POU2F1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Oct, Otf, Oct-, Oct1, Otf-, Otf1, NF-A1, Oct-1, Otf-1, 2810482H01Rik

UniProt

P25425

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of mouse POU2F1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VTSSTATTLTVNPVLPLTSAAVTNLSLTGKQQPAYRLVSTVPVRFLWRTA

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Mouse

Tested Applications

WB

NCBI Accession Number

NP_945150

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CD8 alpha Antibody (fCD8) [Alexa Fluor 405]
NBP1-28254AF405 0.1 mL

Mouse Monoclonal CD8 alpha Antibody (fCD8) [Alexa Fluor 405]

Sign In for Pricing
View Details
Non-oxidizing solvent for dissolving hydrophobic peptides contains Cys, Met, Trp
TFAS15-2 2 mL

Non-oxidizing solvent for dissolving hydrophobic peptides contains Cys, Met, Trp

Sign In for Pricing
View Details
SOD1 (Cu/Zn) Antibody (APC)
orb151410 100 µg

SOD1 (Cu/Zn) Antibody (APC)

Sign In for Pricing
View Details
NFkB, p50 (NF-kB, Nuclear Factor kappa B p50 Subunit, Nuclear Factor of kappa Light Polypeptide Gene Enhancer in B cells 1, NFkB1, DKFZp686C01211, DNA Binding Factor KBF1, EBP-1, KBF1, MGC54151, NF-kappa-B, NF-kB, Nuclear Factor kappa B DNA Binding Subunit) discontinued
N2301-51C 50 µg

NFkB, p50 (NF-kB, Nuclear Factor kappa B p50 Subunit, Nuclear Factor of kappa Light Polypeptide Gene Enhancer in B cells 1, NFkB1, DKFZp686C01211, DNA Binding Factor KBF1, EBP-1, KBF1, MGC54151, NF-kappa-B, NF-kB, Nuclear Factor kappa B DNA Binding Subunit) discontinued

Sign In for Pricing
View Details
Human Aquaporin-4 (AQP4) CLIA Kit
abx195186-01 96 Tests

Human Aquaporin-4 (AQP4) CLIA Kit

Sign In for Pricing
View Details
Human Aquaporin-4 (AQP4) CLIA Kit
abx195186-02 5x 96 Tests

Human Aquaporin-4 (AQP4) CLIA Kit

Sign In for Pricing
View Details