Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

L3mbtl Rabbit Polyclonal Antibody (Biotin)

L3mbtl Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

L3MBT, L3mbtl, mKIAA0681, C630004G01

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human L3mbtl

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KVRPPHSFLVNMKLEAVDRRNPALIRVASVEDVEDHRIKLHFDGWSHNYD

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

67kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

XP_485097

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRTO4, NT (MRTO4, C1orf33, MRT4, mRNA turnover protein 4 homolog) (PE) discontinued
038614-PE 200 µL

MRTO4, NT (MRTO4, C1orf33, MRT4, mRNA turnover protein 4 homolog) (PE) discontinued

Sign In for Pricing
View Details
Fgfbp3 3'UTR Lenti-reporter-Luc Vector
20515086 1.0 µg

Fgfbp3 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
WNK4 Antibody
MBS8596005-01 0.1 mg

WNK4 Antibody

Sign In for Pricing
View Details
WNK4 Antibody
MBS8596005-02 0.1 mL (AF405L)

WNK4 Antibody

Sign In for Pricing
View Details
WNK4 Antibody
MBS8596005-03 0.1 mL (AF405S)

WNK4 Antibody

Sign In for Pricing
View Details
WNK4 Antibody
MBS8596005-04 0.1 mL (AF610)

WNK4 Antibody

Sign In for Pricing
View Details