Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF12 Rabbit Polyclonal Antibody (FITC)

ZNF12 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

KOX3, HZF11, GIOT-3, ZNF325

UniProt

P17014

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF12

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ADECSGCGKSLLHIKLEKTHPGDQAYEFNQNGEPYTLNEESLYQKIRILE

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

77kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Rat

Tested Applications

WB

NCBI Accession Number

NP_057349

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Protocadherin Gamma A2 (PCDHgA2) Magnetic Fluorescence Assay Kit
MBS2159656-01 96 Tests

Protocadherin Gamma A2 (PCDHgA2) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Protocadherin Gamma A2 (PCDHgA2) Magnetic Fluorescence Assay Kit
MBS2159656-02 5x 96 Tests

Protocadherin Gamma A2 (PCDHgA2) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Protocadherin Gamma A2 (PCDHgA2) Magnetic Fluorescence Assay Kit
MBS2159656-03 10x 96 Tests

Protocadherin Gamma A2 (PCDHgA2) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
TNNT3 Over-expression Lysate Product
GWB-79F880 0.1 mg

TNNT3 Over-expression Lysate Product

Sign In for Pricing
View Details
EphA1, NT (EPHA1, EPH, EPHT, EPHT1, Ephrin type-A receptor 1, EPH tyrosine kinase, EPH tyrosine kinase 1, Erythropoietin-producing hepatoma receptor, Tyrosine-protein kinase receptor EPH) (Biotin) discontinued
035115-Biotin 200 µL

EphA1, NT (EPHA1, EPH, EPHT, EPHT1, Ephrin type-A receptor 1, EPH tyrosine kinase, EPH tyrosine kinase 1, Erythropoietin-producing hepatoma receptor, Tyrosine-protein kinase receptor EPH) (Biotin) discontinued

Sign In for Pricing
View Details
Recombinant Escherichia coli Phospho-N-acetylmuramoyl-pentapeptide-transferase (mraY), partial
MBS7075836 Inquire

Recombinant Escherichia coli Phospho-N-acetylmuramoyl-pentapeptide-transferase (mraY), partial

Sign In for Pricing
View Details