Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pias2 Rabbit Polyclonal Antibody (HRP)

Pias2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Di, PI, DIP, Dib, Miz, Miz1, PIAS, SIZ2, ARIP3, PIASxb, AI462206, AU018068, PIASxbeta, PIASxalpha, PIASxalpha6

UniProt

Q8C5D8

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SVFSLDGSSSPVEPDLPVAGIHSLPSTSITPHSPSSPVGSVLLQDTKPTF

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

68kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_032628

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Osteoprotegerin Rabbit Polyclonal Antibody
R1608-4 100 µL

Osteoprotegerin Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GFAP (GA-5 + ASTRO/789), CF640R conjugate, 0.1mg/mL
BNC400898-500 1x 500 µL

GFAP (GA-5 + ASTRO/789), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant CD81 Antibody
RC-16994-01 50 μL

Recombinant CD81 Antibody

Sign In for Pricing
View Details
Recombinant CD81 Antibody
RC-16994-02 100 µL

Recombinant CD81 Antibody

Sign In for Pricing
View Details
Recombinant CD81 Antibody
RC-16994-03 1 mL

Recombinant CD81 Antibody

Sign In for Pricing
View Details
Biotin Anti-Human HLA-A, B, C Antibody[W6/32]
E-AB-F1130B-01 25 µg

Biotin Anti-Human HLA-A, B, C Antibody[W6/32]

Sign In for Pricing
View Details