Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SFPI1 Rabbit Polyclonal Antibody (HRP)

SFPI1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Sf, Sp, Dis, PU., Sfp, Dis1, PU.1, Dis-1, Sfpi1, Spi-1, Tcfpu, Tfpu., Sfpi-1, Tcfpu1, Tfpu.1

UniProt

P17433

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse SFPI1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NEFENFPENHFTELQSVQPPQLQQLYRHMELEQMHVLDTPMVPPHTGLSH

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_035485

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STON1 (NM_006873) Human Recombinant Protein
TP317975L 1 mg

STON1 (NM_006873) Human Recombinant Protein

Sign In for Pricing
View Details
Human CCL28 activation kit by CRISPRa
GA111190 1 Kit

Human CCL28 activation kit by CRISPRa

Sign In for Pricing
View Details
Fruquintinib O-Desquinazolyl,-O-glucuronide
TRC-F965640-5MG 5 mg

Fruquintinib O-Desquinazolyl,-O-glucuronide

Sign In for Pricing
View Details
Cldn22 Mouse Gene Knockout Kit (CRISPR)
KN503413 1 Kit

Cldn22 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DTX4 Human Gene Knockout Kit (CRISPR)
KN417321 1 Kit

DTX4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Abl (Ab-204) Antibody
8B0404-AAT 50 µg

Abl (Ab-204) Antibody

Sign In for Pricing
View Details