Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Trp53 Rabbit Polyclonal Antibody (FITC)

Trp53 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

P4, p5, bbl, bfy, bhy, p44, p53, Tp53

UniProt

Q549C9

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EEFFEGPSEALRVSGAPAAQDPVTETPGPVAPAPATPWPLSSFVPSQKTY

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_035770

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BCO2 Antibody
E307845 200 µL

BCO2 Antibody

Sign In for Pricing
View Details
Fish Super Oxidase Dimutase, SOD ELISA Kit
MBS1601665-01 48 Well

Fish Super Oxidase Dimutase, SOD ELISA Kit

Sign In for Pricing
View Details
Fish Super Oxidase Dimutase, SOD ELISA Kit
MBS1601665-02 96 Well

Fish Super Oxidase Dimutase, SOD ELISA Kit

Sign In for Pricing
View Details
Fish Super Oxidase Dimutase, SOD ELISA Kit
MBS1601665-03 5x 96 Well

Fish Super Oxidase Dimutase, SOD ELISA Kit

Sign In for Pricing
View Details
Fish Super Oxidase Dimutase, SOD ELISA Kit
MBS1601665-04 10x 96 Well

Fish Super Oxidase Dimutase, SOD ELISA Kit

Sign In for Pricing
View Details
PE Anti-Mouse VISTA Antibody[MIH63]
AN00875D-01 50 Tests

PE Anti-Mouse VISTA Antibody[MIH63]

Sign In for Pricing
View Details