Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ldb2 Rabbit Polyclonal Antibody (FITC)

Ldb2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CLI, Ldb, CLIM, CLP-, Ldb3, CLIM-, CLIM1, CLP-36, AI035351, AW146358

UniProt

O55203

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MSSTPHDPFYSSPFGPFYRRHTPYMVQPEYRIYEMNKRLQSRTEDSDNLW

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_034828

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Research Grade Zeleciment
DHC02012 100 μg

Research Grade Zeleciment

Sign In for Pricing
View Details
Anti-IFN gamma Antibody Picoband®, Dylight550 Conjugate
RP1002-Dylight550 100 µg

Anti-IFN gamma Antibody Picoband®, Dylight550 Conjugate

Sign In for Pricing
View Details
PCTK1 ORF Vector (Human) (pORF)
ORF007602 1.0 µg DNA

PCTK1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Mouse Membrane-spanning 4-domains subfamily A member 3, MS4A3 ELISA Kit
MBS9336890-01 48 Well

Mouse Membrane-spanning 4-domains subfamily A member 3, MS4A3 ELISA Kit

Sign In for Pricing
View Details
Mouse Membrane-spanning 4-domains subfamily A member 3, MS4A3 ELISA Kit
MBS9336890-02 96 Well

Mouse Membrane-spanning 4-domains subfamily A member 3, MS4A3 ELISA Kit

Sign In for Pricing
View Details
Mouse Membrane-spanning 4-domains subfamily A member 3, MS4A3 ELISA Kit
MBS9336890-03 5x 96 Well

Mouse Membrane-spanning 4-domains subfamily A member 3, MS4A3 ELISA Kit

Sign In for Pricing
View Details