Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RUNX1 Rabbit Polyclonal Antibody (FITC)

RUNX1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

AML1, CBFA2, EVI-1, AMLCR1, PEBP2aB, CBF2alpha, AML1-EVI-1, PEBP2alpha

UniProt

B2RMS4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RUNX1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: CTNASTGSALLNPSLPNQSDVVEAEGSHSNSPTNMAPSARLEEAVWRPY

Field of Research

Cancer Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001745

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Staphylococcus epidermidis UPF0457 protein SERP1772 (SERP1772)
MBS1481256-01 0.02 mg (E-Coli)

Recombinant Staphylococcus epidermidis UPF0457 protein SERP1772 (SERP1772)

Sign In for Pricing
View Details
Recombinant Staphylococcus epidermidis UPF0457 protein SERP1772 (SERP1772)
MBS1481256-02 0.1 mg (E-Coli)

Recombinant Staphylococcus epidermidis UPF0457 protein SERP1772 (SERP1772)

Sign In for Pricing
View Details
Recombinant Staphylococcus epidermidis UPF0457 protein SERP1772 (SERP1772)
MBS1481256-03 0.02 mg (Yeast)

Recombinant Staphylococcus epidermidis UPF0457 protein SERP1772 (SERP1772)

Sign In for Pricing
View Details
Recombinant Staphylococcus epidermidis UPF0457 protein SERP1772 (SERP1772)
MBS1481256-04 0.1 mg (Yeast)

Recombinant Staphylococcus epidermidis UPF0457 protein SERP1772 (SERP1772)

Sign In for Pricing
View Details
Recombinant Staphylococcus epidermidis UPF0457 protein SERP1772 (SERP1772)
MBS1481256-05 0.02 mg (Baculovirus)

Recombinant Staphylococcus epidermidis UPF0457 protein SERP1772 (SERP1772)

Sign In for Pricing
View Details
Recombinant Staphylococcus epidermidis UPF0457 protein SERP1772 (SERP1772)
MBS1481256-06 1 mg (E-Coli)

Recombinant Staphylococcus epidermidis UPF0457 protein SERP1772 (SERP1772)

Sign In for Pricing
View Details