Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E2F3 Rabbit Polyclonal Antibody (HRP)

E2F3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

E2F-3

UniProt

Q68DT0

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human E2F3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LLQQTEDQIPSNLEGPFVNLLPPLLQEDYLLSLGEEEGISDLFDAYDLEK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

CAH18140

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HNRNPM, NT (HNRNPM, HNRPM, NAGR1, Heterogeneous nuclear ribonucleoprotein M) (MaxLight 405) discontinued
036667-ML405 100 µL

HNRNPM, NT (HNRNPM, HNRPM, NAGR1, Heterogeneous nuclear ribonucleoprotein M) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Canagliflozin (hemihydrate)
C6434-500 500 mg

Canagliflozin (hemihydrate)

Sign In for Pricing
View Details
LSP1, ID (LSP1, WP34, Lymphocyte-specific protein 1, 47kD actin-binding protein, 52kD phosphoprotein, Lymphocyte-specific antigen WP34) (Azide free) (HRP) discontinued
037998-HRP 200 µL

LSP1, ID (LSP1, WP34, Lymphocyte-specific protein 1, 47kD actin-binding protein, 52kD phosphoprotein, Lymphocyte-specific antigen WP34) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Mouse Leucine-rich repeat and IQ domain-containing protein 3, LRRIQ3 ELISA Kit
MBS9335028-01 48 Well

Mouse Leucine-rich repeat and IQ domain-containing protein 3, LRRIQ3 ELISA Kit

Sign In for Pricing
View Details
Mouse Leucine-rich repeat and IQ domain-containing protein 3, LRRIQ3 ELISA Kit
MBS9335028-02 96 Well

Mouse Leucine-rich repeat and IQ domain-containing protein 3, LRRIQ3 ELISA Kit

Sign In for Pricing
View Details
Mouse Leucine-rich repeat and IQ domain-containing protein 3, LRRIQ3 ELISA Kit
MBS9335028-03 5x 96 Well

Mouse Leucine-rich repeat and IQ domain-containing protein 3, LRRIQ3 ELISA Kit

Sign In for Pricing
View Details