Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hpcal1 Rabbit Polyclonal Antibody (Biotin)

Hpcal1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

N, V, Nvp3, NVL-3, NVP-3, Vnsl3, Vsnl3, VILIP3

UniProt

P62748

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: FSMYDLDGNGYISRSEMLEIVQAIYKMVSSVMKMPEDESTPEKRTDKIFR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_057886

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Donkey Polyclonal Donkey anti-Sheep IgG (H+L) Secondary Antibody [DyLight 549] (Pre-absorbed)
NBP1-73003 100 µg

Donkey Polyclonal Donkey anti-Sheep IgG (H+L) Secondary Antibody [DyLight 549] (Pre-absorbed)

Sign In for Pricing
View Details
Human IL-10 ELISPOT kit
CT235-PB5 5 Plates

Human IL-10 ELISPOT kit

Sign In for Pricing
View Details
APC anti-human CD204
GT15281 100 Tests

APC anti-human CD204

Sign In for Pricing
View Details
PMP22 Mouse Monoclonal Antibody [Clone ID: OTI5D1]
TA808964S 30 µL

PMP22 Mouse Monoclonal Antibody [Clone ID: OTI5D1]

Sign In for Pricing
View Details
Mouse Tmem250-ps activation kit by CRISPRa
GA212220 1 Kit

Mouse Tmem250-ps activation kit by CRISPRa

Sign In for Pricing
View Details
Mouse Monoclonal p27/Kip1 Antibody (225501) [Alexa Fluor 700]
FAB2256N 0.1 mL

Mouse Monoclonal p27/Kip1 Antibody (225501) [Alexa Fluor 700]

Sign In for Pricing
View Details