Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JUNB Rabbit Polyclonal Antibody (FITC)

JUNB Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

AP-1

UniProt

P17275

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human JUNB

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: YGRAPGGLSLHDYKLLKPSLAVNLADPYRSLKAPGARGPGPEGGGGGSYF

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_002220

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calmodulin Binding Peptide 1
M30408-01 100 mg

Calmodulin Binding Peptide 1

Sign In for Pricing
View Details
Calmodulin Binding Peptide 1
M30408-02 200 mg

Calmodulin Binding Peptide 1

Sign In for Pricing
View Details
Calmodulin Binding Peptide 1
M30408-03 500 mg

Calmodulin Binding Peptide 1

Sign In for Pricing
View Details
Calmodulin Binding Peptide 1
M30408-04 Inquire

Calmodulin Binding Peptide 1

Sign In for Pricing
View Details
CCR3, ID (CD193, CC Chemokine Receptor Type 3, CC CKR 3, CC CKR3, B Chemokine Receptor, CMKBR3, Eosinophil CC Chemokine Receptor 3, Eosinophil Eotaxin Receptor, MGC102841) (Biotin)
MBS6467886-01 0.2 mL

CCR3, ID (CD193, CC Chemokine Receptor Type 3, CC CKR 3, CC CKR3, B Chemokine Receptor, CMKBR3, Eosinophil CC Chemokine Receptor 3, Eosinophil Eotaxin Receptor, MGC102841) (Biotin)

Sign In for Pricing
View Details
CCR3, ID (CD193, CC Chemokine Receptor Type 3, CC CKR 3, CC CKR3, B Chemokine Receptor, CMKBR3, Eosinophil CC Chemokine Receptor 3, Eosinophil Eotaxin Receptor, MGC102841) (Biotin)
MBS6467886-02 5x 0.2 mL

CCR3, ID (CD193, CC Chemokine Receptor Type 3, CC CKR 3, CC CKR3, B Chemokine Receptor, CMKBR3, Eosinophil CC Chemokine Receptor 3, Eosinophil Eotaxin Receptor, MGC102841) (Biotin)

Sign In for Pricing
View Details