Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JUNB Rabbit Polyclonal Antibody (FITC)

JUNB Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

AP-1

UniProt

P17275

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human JUNB

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: YGRAPGGLSLHDYKLLKPSLAVNLADPYRSLKAPGARGPGPEGGGGGSYF

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_002220

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTEN Polyclonal Antibody, PE-Cy5 Conjugated
bs-0686R-PE-Cy5-TR 20 µL

PTEN Polyclonal Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
CD26 (ADABP, ADCP2, Adenosine Deaminase Complexing Protein 2, Dipeptidyl Peptidase IV, Dipeptidylpeptidase 4, DPP4, DPPIV, Intestinal Dipeptidyl Peptidase, T cell Activation Antigen CD26, TP103) (MaxLight 490)
MBS6253509-01 0.1 mL

CD26 (ADABP, ADCP2, Adenosine Deaminase Complexing Protein 2, Dipeptidyl Peptidase IV, Dipeptidylpeptidase 4, DPP4, DPPIV, Intestinal Dipeptidyl Peptidase, T cell Activation Antigen CD26, TP103) (MaxLight 490)

Sign In for Pricing
View Details
CD26 (ADABP, ADCP2, Adenosine Deaminase Complexing Protein 2, Dipeptidyl Peptidase IV, Dipeptidylpeptidase 4, DPP4, DPPIV, Intestinal Dipeptidyl Peptidase, T cell Activation Antigen CD26, TP103) (MaxLight 490)
MBS6253509-02 5x 0.1 mL

CD26 (ADABP, ADCP2, Adenosine Deaminase Complexing Protein 2, Dipeptidyl Peptidase IV, Dipeptidylpeptidase 4, DPP4, DPPIV, Intestinal Dipeptidyl Peptidase, T cell Activation Antigen CD26, TP103) (MaxLight 490)

Sign In for Pricing
View Details
Fish Transcription Intermediary Factor 1-Beta (TRIM28) ELISA Kit
MBS9902701 Inquire

Fish Transcription Intermediary Factor 1-Beta (TRIM28) ELISA Kit

Sign In for Pricing
View Details
MTND5P8 Protein Vector (Human) (pPM-C-HA)
PV102684 500 ng

MTND5P8 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Lamtor5 (NM_001106462) Rat Tagged ORF Clone Lentiviral Particle
RR207069L4V 200 µL

Lamtor5 (NM_001106462) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details