Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF264 Rabbit Polyclonal Antibody (HRP)

ZNF264 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

O43296

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF264

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SGQTSVTLRELLLGKDFLNVTTEANILPEETSSSASDQPYQRETPQVSSL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

71kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_003408

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HES1, NT (Hairy and Enhancer of Split 1, HES-1, bHLHb39, Class B Basic Helix-loop-helix Protein 39, FLJ20408, Hairy Homolog, Hairy-like Protein, hHL, HL, HRY, Transcription Factor HES-1) (HRP)
MBS6480143-01 0.2 mL

HES1, NT (Hairy and Enhancer of Split 1, HES-1, bHLHb39, Class B Basic Helix-loop-helix Protein 39, FLJ20408, Hairy Homolog, Hairy-like Protein, hHL, HL, HRY, Transcription Factor HES-1) (HRP)

Sign In for Pricing
View Details
HES1, NT (Hairy and Enhancer of Split 1, HES-1, bHLHb39, Class B Basic Helix-loop-helix Protein 39, FLJ20408, Hairy Homolog, Hairy-like Protein, hHL, HL, HRY, Transcription Factor HES-1) (HRP)
MBS6480143-02 5x 0.2 mL

HES1, NT (Hairy and Enhancer of Split 1, HES-1, bHLHb39, Class B Basic Helix-loop-helix Protein 39, FLJ20408, Hairy Homolog, Hairy-like Protein, hHL, HL, HRY, Transcription Factor HES-1) (HRP)

Sign In for Pricing
View Details
RPRD1B (C20orf77, CREPT, Regulation of Nuclear Pre-mRNA Domain-containing Protein 1B, Cell Cycle-related and Expression-elevated Protein in Tumor, DKFZp434P0735, FLJ44520) (MaxLight 405)
MBS6192393-01 0.1 mL

RPRD1B (C20orf77, CREPT, Regulation of Nuclear Pre-mRNA Domain-containing Protein 1B, Cell Cycle-related and Expression-elevated Protein in Tumor, DKFZp434P0735, FLJ44520) (MaxLight 405)

Sign In for Pricing
View Details
RPRD1B (C20orf77, CREPT, Regulation of Nuclear Pre-mRNA Domain-containing Protein 1B, Cell Cycle-related and Expression-elevated Protein in Tumor, DKFZp434P0735, FLJ44520) (MaxLight 405)
MBS6192393-02 5x 0.1 mL

RPRD1B (C20orf77, CREPT, Regulation of Nuclear Pre-mRNA Domain-containing Protein 1B, Cell Cycle-related and Expression-elevated Protein in Tumor, DKFZp434P0735, FLJ44520) (MaxLight 405)

Sign In for Pricing
View Details
SSRP1 (NM_003146) Human Over-expression Lysate
LS006749-20ug 20 µg

SSRP1 (NM_003146) Human Over-expression Lysate

Sign In for Pricing
View Details
Anti-Barley HvCPR5-1 P0413C03.36-1 Antibody, Cy3 Conjugate
DZ33942-Cy3 200 µL/Vial

Anti-Barley HvCPR5-1 P0413C03.36-1 Antibody, Cy3 Conjugate

Sign In for Pricing
View Details