Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMELESS Rabbit Polyclonal Antibody (HRP)

TIMELESS Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TIM, TIM1, hTIM

UniProt

Q9UNS1

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TIMELESS

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MDLHMMNCELLATCSALGYLEGDTYHKEPDCLESVKDLIRYLRHEDETRD

Field of Research

Epigenetics & Chromatin

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

139kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003911

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Growth Hormone Binding Protein (GH) discontinued
169530 500 µg

Growth Hormone Binding Protein (GH) discontinued

Sign In for Pricing
View Details
Goat F(ab')2 Anti-Mouse IgG (H+L), Human ads-FITC
MBS674404-01 0.5 mg

Goat F(ab')2 Anti-Mouse IgG (H+L), Human ads-FITC

Sign In for Pricing
View Details
Goat F(ab')2 Anti-Mouse IgG (H+L), Human ads-FITC
MBS674404-02 5x 0.5 mg

Goat F(ab')2 Anti-Mouse IgG (H+L), Human ads-FITC

Sign In for Pricing
View Details
DPY19L1, CT (DPY19L1, GA0500, KIAA0877, Protein dpy-19 homolog 1, Dpy-19-like protein 1) (MaxLight 490)
MBS6293417-01 0.1 mL

DPY19L1, CT (DPY19L1, GA0500, KIAA0877, Protein dpy-19 homolog 1, Dpy-19-like protein 1) (MaxLight 490)

Sign In for Pricing
View Details
DPY19L1, CT (DPY19L1, GA0500, KIAA0877, Protein dpy-19 homolog 1, Dpy-19-like protein 1) (MaxLight 490)
MBS6293417-02 5x 0.1 mL

DPY19L1, CT (DPY19L1, GA0500, KIAA0877, Protein dpy-19 homolog 1, Dpy-19-like protein 1) (MaxLight 490)

Sign In for Pricing
View Details
Progesterone Receptor Blocking Peptide
MBS9618708-01 1 mg

Progesterone Receptor Blocking Peptide

Sign In for Pricing
View Details