Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Klf4 Rabbit Polyclonal Antibody (FITC)

Klf4 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Zi, EZF, Gkl, Zie, Gklf

UniProt

Q60793

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MRQPPGESDMAVSDALLPSFSTFASGPAGREKTLRPAGAPTNRWREELSH

Field of Research

Cancer Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_034767

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Cacng5 shRNA (UAS) - Lentiviral mouse Cacng5 shRNA (UAS, GFP) plasmid
GTR15261466 1 Vial

Lentiviral mouse Cacng5 shRNA (UAS) - Lentiviral mouse Cacng5 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Anti-RLN3 Antibody Picoband® Fluoro488 Conjugated
A05495-2-Fluoro488 100 µg/Vial

Anti-RLN3 Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details
Rabbit Anti Human KIF3A Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4)(Western Blot, IHC, ELISA)
MBS8424137-01 0.12 mL

Rabbit Anti Human KIF3A Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4)(Western Blot, IHC, ELISA)

Sign In for Pricing
View Details
Rabbit Anti Human KIF3A Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4)(Western Blot, IHC, ELISA)
MBS8424137-02 0.2 mL

Rabbit Anti Human KIF3A Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4)(Western Blot, IHC, ELISA)

Sign In for Pricing
View Details
Rabbit Anti Human KIF3A Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4)(Western Blot, IHC, ELISA)
MBS8424137-03 5x 0.2 mL

Rabbit Anti Human KIF3A Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4)(Western Blot, IHC, ELISA)

Sign In for Pricing
View Details
DOV-102677
T69275-01 25 mg

DOV-102677

Sign In for Pricing
View Details