Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLA2G4B Rabbit Polyclonal Antibody (Biotin)

PLA2G4B Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HsT16992, cPLA2-beta

UniProt

P0C869

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PLA2G4B

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: AEAALEAVRSELREFPAAARELCVPLAVPYLDKPPTPLHFYRDWVCPNRP

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

114kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_005081

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CASC4 Antibody (C-term)
orb1938927-01 50 µL

CASC4 Antibody (C-term)

Sign In for Pricing
View Details
CASC4 Antibody (C-term)
orb1938927-02 100 µL

CASC4 Antibody (C-term)

Sign In for Pricing
View Details
Macrophage Inflammatory Protein 3 Alpha (MIP3a) DIY ELISA Kit
MBS2162949-01 5x 96 Tests

Macrophage Inflammatory Protein 3 Alpha (MIP3a) DIY ELISA Kit

Sign In for Pricing
View Details
Macrophage Inflammatory Protein 3 Alpha (MIP3a) DIY ELISA Kit
MBS2162949-02 5x 96 Tests + MBS2089471 (Support Pack 1,5x 96 Tests)

Macrophage Inflammatory Protein 3 Alpha (MIP3a) DIY ELISA Kit

Sign In for Pricing
View Details
Macrophage Inflammatory Protein 3 Alpha (MIP3a) DIY ELISA Kit
MBS2162949-03 10x 96 Tests

Macrophage Inflammatory Protein 3 Alpha (MIP3a) DIY ELISA Kit

Sign In for Pricing
View Details
Macrophage Inflammatory Protein 3 Alpha (MIP3a) DIY ELISA Kit
MBS2162949-04 10x 96 Tests + MBS2089471 (Support Pack 1, 10x 96 Tests)

Macrophage Inflammatory Protein 3 Alpha (MIP3a) DIY ELISA Kit

Sign In for Pricing
View Details