Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SAP18 Rabbit Polyclonal Antibody (HRP)

SAP18 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SAP18P, 2HOR0202

UniProt

O00422

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SAP18

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EIKKEPEKPIDREKTCPLLLRVFTTNNGRHHRMDEFSRGNVPSSELQIYT

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

18kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_005861

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CGREF1 3'UTR GFP Stable Cell Line
TU054307 1.0 mL

CGREF1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Recombinant Rickettsia conorii Outer membrane protein A (ompA), partial
CSB-BP706579RMS-01 20 µg

Recombinant Rickettsia conorii Outer membrane protein A (ompA), partial

Sign In for Pricing
View Details
Recombinant Rickettsia conorii Outer membrane protein A (ompA), partial
CSB-BP706579RMS-02 100 µg

Recombinant Rickettsia conorii Outer membrane protein A (ompA), partial

Sign In for Pricing
View Details
Recombinant Rickettsia conorii Outer membrane protein A (ompA), partial
CSB-BP706579RMS-03 1 mg

Recombinant Rickettsia conorii Outer membrane protein A (ompA), partial

Sign In for Pricing
View Details
USP26 Protein Vector (Rat) (pPM-C-His)
PV314769 500 ng

USP26 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Cy3 Linked Monoclonal Antibody to Complement Component 5a (C5a)
MBS2129275-01 0.1 mL

Cy3 Linked Monoclonal Antibody to Complement Component 5a (C5a)

Sign In for Pricing
View Details