Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POLR2I Rabbit Polyclonal Antibody (HRP)

POLR2I Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RPB9, hRPB14.5

UniProt

P36954

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human POLR2I

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EPDGTYEPGFVGIRFCQECNNMLYPKEDKENRILLYACRNCDYQQEADNS

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

14kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006224

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WM-1-3-PK AB Labels
012200 Pack of 900 Label(s)

WM-1-3-PK AB Labels

Sign In for Pricing
View Details
Sgms1 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
43632154 3x 1.0 µg DNA

Sgms1 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
RICH2 AAV Vector (Human) (CMV)
39577102 1 µg

RICH2 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
STEAP3 (Metalloreductase STEAP3, Dudulin-2, Six-transmembrane Epithelial Antigen of Prostate 3, Tumor Suppressor-activated Pathway Protein 6, hTSAP6, pHyde, hpHyde, TSAP6) (APC)
MBS6402848-01 0.1 mL

STEAP3 (Metalloreductase STEAP3, Dudulin-2, Six-transmembrane Epithelial Antigen of Prostate 3, Tumor Suppressor-activated Pathway Protein 6, hTSAP6, pHyde, hpHyde, TSAP6) (APC)

Sign In for Pricing
View Details
STEAP3 (Metalloreductase STEAP3, Dudulin-2, Six-transmembrane Epithelial Antigen of Prostate 3, Tumor Suppressor-activated Pathway Protein 6, hTSAP6, pHyde, hpHyde, TSAP6) (APC)
MBS6402848-02 5x 0.1 mL

STEAP3 (Metalloreductase STEAP3, Dudulin-2, Six-transmembrane Epithelial Antigen of Prostate 3, Tumor Suppressor-activated Pathway Protein 6, hTSAP6, pHyde, hpHyde, TSAP6) (APC)

Sign In for Pricing
View Details
Monoclonal Vimentin (Mesenchymal Cell Marker) Antibody - Without BSA and Azide, Clone: SPM576
AMM00427G 0.1mg

Monoclonal Vimentin (Mesenchymal Cell Marker) Antibody - Without BSA and Azide, Clone: SPM576

Sign In for Pricing
View Details