Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMC1A Rabbit Polyclonal Antibody (HRP)

SMC1A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SMC1, SMCB, CDLS2, DEE85, SB1.8, EIEE85, SMC1L1, DXS423E, SMC1alpha

UniProt

Q14683

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human SMC1A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VISLKEEFYTKAESLIGVYPEQGDCVISKVLTFDLTKYPDANPNPNEQ

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

143kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_006297

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human NDUFB3 shRNA (UAS) - Lentiviral human NDUFB3 shRNA (UAS, GFP) plasmid
GTR15107206 1 Vial

Lentiviral human NDUFB3 shRNA (UAS) - Lentiviral human NDUFB3 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Myosin 1C, ID (Myosin I beta, MMI-beta, MMIb, Myosin-Ic, MYO1C) (MaxLight 550)
MBS6489082-01 0.1 mL

Myosin 1C, ID (Myosin I beta, MMI-beta, MMIb, Myosin-Ic, MYO1C) (MaxLight 550)

Sign In for Pricing
View Details
Myosin 1C, ID (Myosin I beta, MMI-beta, MMIb, Myosin-Ic, MYO1C) (MaxLight 550)
MBS6489082-02 5x 0.1 mL

Myosin 1C, ID (Myosin I beta, MMI-beta, MMIb, Myosin-Ic, MYO1C) (MaxLight 550)

Sign In for Pricing
View Details
RANBP9 Antibody - N-terminal region
ARP76952_P050-25UL 25 µL

RANBP9 Antibody - N-terminal region

Sign In for Pricing
View Details
Mesulergine hydrochloride
MBS5757446 Inquire

Mesulergine hydrochloride

Sign In for Pricing
View Details
LSM1 polyclonal antibody
BS60034 50ul

LSM1 polyclonal antibody

Sign In for Pricing
View Details