Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARID3B Rabbit Polyclonal Antibody (FITC)

ARID3B Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

BDP, DRIL2

UniProt

O95443

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ARID3B

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: AQKPVVHLITGSAPQSLGSSASSSSSSHCSPSPTSSRGTPSAEPSTSWSL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

61kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_006456

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

S47A2, NT (SLC47A2, MATE2, Multidrug and toxin extrusion protein 2, Kidney-specific H(+)/organic cation antiporter, Solute carrier family 47 member 2) (MaxLight 650)
MBS6344796-01 0.1 mL

S47A2, NT (SLC47A2, MATE2, Multidrug and toxin extrusion protein 2, Kidney-specific H(+)/organic cation antiporter, Solute carrier family 47 member 2) (MaxLight 650)

Sign In for Pricing
View Details
S47A2, NT (SLC47A2, MATE2, Multidrug and toxin extrusion protein 2, Kidney-specific H(+)/organic cation antiporter, Solute carrier family 47 member 2) (MaxLight 650)
MBS6344796-02 5x 0.1 mL

S47A2, NT (SLC47A2, MATE2, Multidrug and toxin extrusion protein 2, Kidney-specific H(+)/organic cation antiporter, Solute carrier family 47 member 2) (MaxLight 650)

Sign In for Pricing
View Details
Mouse 25 Hydroxy Vitamin D (25 Hydroxy Vitamin D) ELISA Kit
orb1100872-01 48 Tests

Mouse 25 Hydroxy Vitamin D (25 Hydroxy Vitamin D) ELISA Kit

Sign In for Pricing
View Details
Mouse 25 Hydroxy Vitamin D (25 Hydroxy Vitamin D) ELISA Kit
orb1100872-02 96 Tests

Mouse 25 Hydroxy Vitamin D (25 Hydroxy Vitamin D) ELISA Kit

Sign In for Pricing
View Details
BUB1 (Budding Uninhibited by Benzimidazoles 1, BUB1A, BUB1L, HBUB1) (MaxLight 405)
MBS6194089-01 0.1 mL

BUB1 (Budding Uninhibited by Benzimidazoles 1, BUB1A, BUB1L, HBUB1) (MaxLight 405)

Sign In for Pricing
View Details
BUB1 (Budding Uninhibited by Benzimidazoles 1, BUB1A, BUB1L, HBUB1) (MaxLight 405)
MBS6194089-02 5x 0.1 mL

BUB1 (Budding Uninhibited by Benzimidazoles 1, BUB1A, BUB1L, HBUB1) (MaxLight 405)

Sign In for Pricing
View Details