Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hoxc9 Rabbit Polyclonal Antibody (HRP)

Hoxc9 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Hox-3., Hox-3.2

UniProt

P09633

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Hoxc9

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EFLFNMYLTRDRRYEVARVLNLTERQVKIWFQNRRMKMKKMNKEKTDKEQ

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_032298

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IGFBP7 Protein (K95R, His Tag)
600-169-L50 50 µg

IGFBP7 Protein (K95R, His Tag)

Sign In for Pricing
View Details
Helt Antibody - C-terminal region : HRP (ARP37537_P050-HRP)
ARP37537_P050-HRP 100 µL

Helt Antibody - C-terminal region : HRP (ARP37537_P050-HRP)

Sign In for Pricing
View Details
Sialyl-lacto-N-tetraose c-GEL
85/06-0010 1 mL

Sialyl-lacto-N-tetraose c-GEL

Sign In for Pricing
View Details
Mouse C5 ELISA Kit
EMC0363 96 Tests

Mouse C5 ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal Antibody
TA396608 2 mL

Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BRP16, ID (FAM203A, BRP16, C8orf30A, Protein FAM203A, Brain protein 16) (MaxLight 550)
MBS6278952-01 0.1 mL

BRP16, ID (FAM203A, BRP16, C8orf30A, Protein FAM203A, Brain protein 16) (MaxLight 550)

Sign In for Pricing
View Details