Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GTF3C5 Rabbit Polyclonal Antibody (FITC)

GTF3C5 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

TFIIIC63, TFiiiC2-63, TFIIICepsilon

UniProt

Q9Y5Q8

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human GTF3C5

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SKRPALFSSSAKADGGKEQLTYESGEDEEDEEEEEEEEEDFKPSDGSENE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_036219

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP1A1 Antibody
A46991-50UG 50 µg

ATP1A1 Antibody

Sign In for Pricing
View Details
SNAR-A12 CRISPR All-in-one AAV vector set (with saCas9)(Human)
44515151 3x 1.0 µg DNA

SNAR-A12 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
UBR2 (E3 Ubiquitin-protein Ligase UBR2, C6orf133, KIAA0349, N-recognin-2, Ubiquitin-protein Ligase E3-alpha-2, Ubiquitin-protein Ligase E3-alpha-II) (MaxLight 650)
MBS6225332-01 0.1 mL

UBR2 (E3 Ubiquitin-protein Ligase UBR2, C6orf133, KIAA0349, N-recognin-2, Ubiquitin-protein Ligase E3-alpha-2, Ubiquitin-protein Ligase E3-alpha-II) (MaxLight 650)

Sign In for Pricing
View Details
UBR2 (E3 Ubiquitin-protein Ligase UBR2, C6orf133, KIAA0349, N-recognin-2, Ubiquitin-protein Ligase E3-alpha-2, Ubiquitin-protein Ligase E3-alpha-II) (MaxLight 650)
MBS6225332-02 5x 0.1 mL

UBR2 (E3 Ubiquitin-protein Ligase UBR2, C6orf133, KIAA0349, N-recognin-2, Ubiquitin-protein Ligase E3-alpha-2, Ubiquitin-protein Ligase E3-alpha-II) (MaxLight 650)

Sign In for Pricing
View Details
DDIT4 (NM_019058) Human Recombinant Protein
PH40649M5 20 µg

DDIT4 (NM_019058) Human Recombinant Protein

Sign In for Pricing
View Details
TRM44 Antibody
MBS9521078-01 0.04 mL

TRM44 Antibody

Sign In for Pricing
View Details