Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CIZ1 Rabbit Polyclonal Antibody (Biotin)

CIZ1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

NP94, LSFR1, ZNF356

UniProt

Q9ULV3

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human CIZ1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: YKAAKNPSPTTRPVSRRCAINARNALTALFTSSGRPPSQPNTQDKTPSKV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

100kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human

Tested Applications

IHC, WB

NCBI Accession Number

NP_036259

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC1A5 Rabbit Polyclonal Antibody (HRP)
orb1599453 100 µL

SLC1A5 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
PLK4/STK18 Rabbit Polyclonal Antibody (Cy3)
orb2450811 100 µL

PLK4/STK18 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
Hras1, CT (Hras1, Hras, GTPase HRas, H-Ras-1, Transforming protein p21, c-H-ras, p21ras, GTPase HRas, N-terminally processed) (Biotin)
MBS6308322-01 0.2 mL

Hras1, CT (Hras1, Hras, GTPase HRas, H-Ras-1, Transforming protein p21, c-H-ras, p21ras, GTPase HRas, N-terminally processed) (Biotin)

Sign In for Pricing
View Details
Hras1, CT (Hras1, Hras, GTPase HRas, H-Ras-1, Transforming protein p21, c-H-ras, p21ras, GTPase HRas, N-terminally processed) (Biotin)
MBS6308322-02 5x 0.2 mL

Hras1, CT (Hras1, Hras, GTPase HRas, H-Ras-1, Transforming protein p21, c-H-ras, p21ras, GTPase HRas, N-terminally processed) (Biotin)

Sign In for Pricing
View Details
Histone H2A.X (Phospho Tyr142) Polyclonal Antibody
MBS2535556-01 0.02 mL

Histone H2A.X (Phospho Tyr142) Polyclonal Antibody

Sign In for Pricing
View Details
Histone H2A.X (Phospho Tyr142) Polyclonal Antibody
MBS2535556-02 0.06 mL

Histone H2A.X (Phospho Tyr142) Polyclonal Antibody

Sign In for Pricing
View Details