Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF281 Rabbit Polyclonal Antibody (HRP)

ZNF281 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GZP1, ZBP99, ZBP-99, ZNP-99

UniProt

Q9Y2X9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZNF281

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PMTFITNSNGEVDHRVRTSVSDFSGYTNMMSDVSEPCSTRVKTPTSQSYR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

97kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_036614

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EPX sgRNA CRISPR Lentivector (Human) (Target 3)
K0689804 1.0 µg DNA

EPX sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Human MMP13 ELISA kit
LF-EK50677 1×96T

Human MMP13 ELISA kit

Sign In for Pricing
View Details
PA (Prealbumin) Chicken ELISA Kit
F6495 96 Tests

PA (Prealbumin) Chicken ELISA Kit

Sign In for Pricing
View Details
APBB3-set siRNA/shRNA/RNAi Lentivector (Human)
12133091 4x 500 ng

APBB3-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Human Beta-glucuronidase, GUSB ELISA KIT
E0731Hu-01 48 Well

Human Beta-glucuronidase, GUSB ELISA KIT

Sign In for Pricing
View Details
Human Beta-glucuronidase, GUSB ELISA KIT
E0731Hu-02 96 Well

Human Beta-glucuronidase, GUSB ELISA KIT

Sign In for Pricing
View Details