Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hoxc11 Rabbit Polyclonal Antibody (HRP)

Hoxc11 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Hox-3., Hox-3.7

UniProt

P31313

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GADFGERGSCTSNLYLPSCTYYVPEFSTVSSFLPQAPSRQISYPYSAQVP

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001020013

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Plasmalemma Vesicle Associated Protein (PLVAP) ELISA Kit
RDR-PLVAP-Hu-01 96 Tests

Human Plasmalemma Vesicle Associated Protein (PLVAP) ELISA Kit

Sign In for Pricing
View Details
Human Plasmalemma Vesicle Associated Protein (PLVAP) ELISA Kit
RDR-PLVAP-Hu-02 48 Tests

Human Plasmalemma Vesicle Associated Protein (PLVAP) ELISA Kit

Sign In for Pricing
View Details
Ficolin 2 (FCN2) (NM_015837) Human Recombinant Protein
TP318750 20 µg

Ficolin 2 (FCN2) (NM_015837) Human Recombinant Protein

Sign In for Pricing
View Details
Basic Water Purification System BBPS-102
BBPS-102 1 Unit

Basic Water Purification System BBPS-102

Sign In for Pricing
View Details
Vmn2r41 Mouse Gene Knockout Kit (CRISPR)
KN519170 1 Kit

Vmn2r41 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Synaptotagmin VII (SYT7) (NM_004200) Human Over-expression Lysate
LY401350 100 µg

Synaptotagmin VII (SYT7) (NM_004200) Human Over-expression Lysate

Sign In for Pricing
View Details