Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TOX4 Rabbit Polyclonal Antibody (Biotin)

TOX4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

LCP1, MIG7, C14orf92, KIAA0737

UniProt

B4DPY8

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human TOX4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RCVRSGCENPPIVSKDWDNEYCSNECVVKHCRDVFLAWVASRNSNTVVFV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

65kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001290452.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal ANP32A Antibody [DyLight 755]
NBP2-99913IR 0.1 mL

Rabbit Polyclonal ANP32A Antibody [DyLight 755]

Sign In for Pricing
View Details
26 x 21 cm filter with stainless steel frame for 312 nm transill µmiator
MUV-F26-312 1 Unit

26 x 21 cm filter with stainless steel frame for 312 nm transill µmiator

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Chordin (CHRD)
MBS2063373-01 0.1 mL

APC-Linked Polyclonal Antibody to Chordin (CHRD)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Chordin (CHRD)
MBS2063373-02 0.2 mL

APC-Linked Polyclonal Antibody to Chordin (CHRD)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Chordin (CHRD)
MBS2063373-03 0.5 mL

APC-Linked Polyclonal Antibody to Chordin (CHRD)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Chordin (CHRD)
MBS2063373-04 1 mL

APC-Linked Polyclonal Antibody to Chordin (CHRD)

Sign In for Pricing
View Details