Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FOXJ3 Rabbit Polyclonal Antibody (HRP)

FOXJ3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MGC165036, MGC176686

UniProt

Q9UPW0

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human FOXJ3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IPQALSTPGTTMAGHHRAMNQQHMMPSQAFQMRRSLPPDDIQDDFDWDSI

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

69kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_055762

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Gkap1 shRNA (UAS) - Lentiviral mouse Gkap1 shRNA (UAS, GFP) plasmid
GTR15180862 1 Vial

Lentiviral mouse Gkap1 shRNA (UAS) - Lentiviral mouse Gkap1 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Recombinant Human Macrophage mannose receptor 1 (MRC1), partial
orb1652883-01 20 µg

Recombinant Human Macrophage mannose receptor 1 (MRC1), partial

Sign In for Pricing
View Details
Recombinant Human Macrophage mannose receptor 1 (MRC1), partial
orb1652883-02 100 µg

Recombinant Human Macrophage mannose receptor 1 (MRC1), partial

Sign In for Pricing
View Details
Recombinant Human Macrophage mannose receptor 1 (MRC1), partial
orb1652883-03 1 mg

Recombinant Human Macrophage mannose receptor 1 (MRC1), partial

Sign In for Pricing
View Details
NFRKB Antibody Blocking Peptide
orb1508509 500 µg

NFRKB Antibody Blocking Peptide

Sign In for Pricing
View Details
UCHL1 antibody (HRP)
60R-2077 0.1 mg

UCHL1 antibody (HRP)

Sign In for Pricing
View Details