Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLHL5 Rabbit Polyclonal Antibody (Biotin)

KLHL5 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q96PQ7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human KLHL5

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LLGDKLYAVGGYDGQAYLNTVEAYDPQTNEWTQVAPLCLGRAGACVVTVK

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

84kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_057074

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Myosin-15, MYH15 ELISA Kit
MBS9317152-01 48 Well

Human Myosin-15, MYH15 ELISA Kit

Sign In for Pricing
View Details
Human Myosin-15, MYH15 ELISA Kit
MBS9317152-02 96 Well

Human Myosin-15, MYH15 ELISA Kit

Sign In for Pricing
View Details
Human Myosin-15, MYH15 ELISA Kit
MBS9317152-03 5x 96 Well

Human Myosin-15, MYH15 ELISA Kit

Sign In for Pricing
View Details
Human Myosin-15, MYH15 ELISA Kit
MBS9317152-04 10x 96 Well

Human Myosin-15, MYH15 ELISA Kit

Sign In for Pricing
View Details
Human Kappa Light Chain (B-Cell Marker) (rKLC264), CF594 conjugate, 0.1mg/mL
BNC942171-100 1x 100 µL

Human Kappa Light Chain (B-Cell Marker) (rKLC264), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Rabbit Monoclonal CTHRC1 Antibody (055) [Janelia Fluor 549]
NBP2-89945JF549 0.1 mL

Rabbit Monoclonal CTHRC1 Antibody (055) [Janelia Fluor 549]

Sign In for Pricing
View Details