Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF580 Rabbit Polyclonal Antibody (Biotin)

ZNF580 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q9UK33

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF580

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KAEGPSSTPSSAAGPRPPRLGRHLLIDANGVPYTYTVQLEEEPRGPPQRE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

19kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_057286

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human CDC34 shRNA (UAS) - Lentiviral human CDC34 shRNA (UAS, GFP) plasmid
GTR15310585 1 Vial

Lentiviral human CDC34 shRNA (UAS) - Lentiviral human CDC34 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
C22orf32 Rabbit pAb, PE-Cy5.5 conjugated
orb2850592 100 µL

C22orf32 Rabbit pAb, PE-Cy5.5 conjugated

Sign In for Pricing
View Details
IL-23R, His, Cynomolgus
Z04838-500 500 µg

IL-23R, His, Cynomolgus

Sign In for Pricing
View Details
Multiplex Assay Kit for S-Adenosyl Methionine (SAM), etc. by FLIA (Flow Luminescence Immunoassay)
TRV-0030974 96 Tests

Multiplex Assay Kit for S-Adenosyl Methionine (SAM), etc. by FLIA (Flow Luminescence Immunoassay)

Sign In for Pricing
View Details
NDEL1 (Nuclear Distribution Gene E Like Homolog 1, EOPA, NDE2, NUDEL, MITAP1, NDE1L1) (FITC)
MBS6428435-01 0.1 mL

NDEL1 (Nuclear Distribution Gene E Like Homolog 1, EOPA, NDE2, NUDEL, MITAP1, NDE1L1) (FITC)

Sign In for Pricing
View Details
NDEL1 (Nuclear Distribution Gene E Like Homolog 1, EOPA, NDE2, NUDEL, MITAP1, NDE1L1) (FITC)
MBS6428435-02 5x 0.1 mL

NDEL1 (Nuclear Distribution Gene E Like Homolog 1, EOPA, NDE2, NUDEL, MITAP1, NDE1L1) (FITC)

Sign In for Pricing
View Details