Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF307 Rabbit Polyclonal Antibody (FITC)

ZNF307 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ZNF307, ZNF427, ZSCAN36, P1P373C6

UniProt

Q969J2

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF307

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: FTRNRSLIEHQKIHTGEKPYQCDTCGKGFTRTSYLVQHQRSHVGKKTLSQ

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

62kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_061983

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey Testis expressed sequence 10 protein (TEX10) ELISA kit
GTR10414821 96 Well

Monkey Testis expressed sequence 10 protein (TEX10) ELISA kit

Sign In for Pricing
View Details
Olr726 CRISPRa sgRNA lentivector (set of three targets)(Rat)
34632126 3x 1.0µg DNA

Olr726 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Sex Hormone Binding Gloulin (SHBG)
MBS2145706-01 0.1 mL

Cy3-Linked Monoclonal Antibody to Sex Hormone Binding Gloulin (SHBG)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Sex Hormone Binding Gloulin (SHBG)
MBS2145706-02 0.2 mL

Cy3-Linked Monoclonal Antibody to Sex Hormone Binding Gloulin (SHBG)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Sex Hormone Binding Gloulin (SHBG)
MBS2145706-03 0.5 mL

Cy3-Linked Monoclonal Antibody to Sex Hormone Binding Gloulin (SHBG)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Sex Hormone Binding Gloulin (SHBG)
MBS2145706-04 1 mL

Cy3-Linked Monoclonal Antibody to Sex Hormone Binding Gloulin (SHBG)

Sign In for Pricing
View Details