Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

METTL3 Rabbit Polyclonal Antibody (Biotin)

METTL3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

M6A, IME4, Spo8, MT-A70, hMETTL3

UniProt

Q86U44

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human METTL3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: IVAEVRSTSHKPDEIYGMIERLSPGTRKIELFGRPHNVQPNWITLGNQLD

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

64kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_062826

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human cyclin D3/CCND3 protein (His tag)
PDEH100920-01 20 µg

Recombinant Human cyclin D3/CCND3 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human cyclin D3/CCND3 protein (His tag)
PDEH100920-02 100 µg

Recombinant Human cyclin D3/CCND3 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human cyclin D3/CCND3 protein (His tag)
PDEH100920-03 500 µg

Recombinant Human cyclin D3/CCND3 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human cyclin D3/CCND3 protein (His tag)
PDEH100920-04 1 mg

Recombinant Human cyclin D3/CCND3 protein (His tag)

Sign In for Pricing
View Details
C14orf93 Mouse Monoclonal Antibody [2-F6]
M1009-3 100 µL

C14orf93 Mouse Monoclonal Antibody [2-F6]

Sign In for Pricing
View Details
RNF149 Mouse Monoclonal Antibody [Clone ID: OTI12C2]
CF810551 100 µg

RNF149 Mouse Monoclonal Antibody [Clone ID: OTI12C2]

Sign In for Pricing
View Details