Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC2A4RG Rabbit Polyclonal Antibody (HRP)

SLC2A4RG Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GEF, HDBP1, HDBP-1, Si-1-2, Si-1-2-19

UniProt

Q9NR83

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human SLC2A4RG

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HSDRVYQGCLTPARLEPQPTEVGACPPALSSRIGVTLRKPRGDAKKCRKV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Mouse, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Colon
CS626752 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
Adipophilin / Perilipin-2 (Marker of Obesity) (ADFP/1366), CF740 conjugate, 0.1mg/mL
BNC741366-500 1x 500 µL

Adipophilin / Perilipin-2 (Marker of Obesity) (ADFP/1366), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Eotaxin (CCL11) activation kit by CRISPRa
GA104319 1 Kit

Human Eotaxin (CCL11) activation kit by CRISPRa

Sign In for Pricing
View Details
ARSB Mouse Monoclonal Antibody [Clone ID: OTI4G7]
CF812949 100 µg

ARSB Mouse Monoclonal Antibody [Clone ID: OTI4G7]

Sign In for Pricing
View Details
Human ZNF260 activation kit by CRISPRa
GA117415 1 Kit

Human ZNF260 activation kit by CRISPRa

Sign In for Pricing
View Details
MDH1 Human Gene Knockout Kit (CRISPR)
KN400298 1 Kit

MDH1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details