Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOXB7 Rabbit Polyclonal Antibody (HRP)

HOXB7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HOX2, HOX2C, HHO.C1, Hox-2.3

UniProt

P09629

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human HOXB7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IEIAHTLCLTERQIKIWFQNRRMKWKKENKTAGPGTTGQDRAEAEEEEEE

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Rat

Tested Applications

IF, WB

NCBI Accession Number

NP_004493

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Petunia sp. Chlorophyll a-b binding protein 25, chloroplastic (CAB25)
MBS7010646-01 0.02 mg

Recombinant Petunia sp. Chlorophyll a-b binding protein 25, chloroplastic (CAB25)

Sign In for Pricing
View Details
Recombinant Petunia sp. Chlorophyll a-b binding protein 25, chloroplastic (CAB25)
MBS7010646-02 0.1 mg

Recombinant Petunia sp. Chlorophyll a-b binding protein 25, chloroplastic (CAB25)

Sign In for Pricing
View Details
Recombinant Petunia sp. Chlorophyll a-b binding protein 25, chloroplastic (CAB25)
MBS7010646-03 5x 0.1 mg

Recombinant Petunia sp. Chlorophyll a-b binding protein 25, chloroplastic (CAB25)

Sign In for Pricing
View Details
GAD-65/67 (Glutamate Decarboxylase 2, 65kD Glutamic acid Decarboxylase, GAD 65, Glutamate Decarboxylase 65kD Isoform, GAD2, GAD-65, GAD 2, GAD-2, Glutamate Decarboxylase 1, 67kD Glutamic acid Decarboxylase, GAD 67, Glutamate Decarboxylase 67kD Isoform, GAD1, GAD, GAD67, GAD-1, GAD 1)
222842-01 50 µL

GAD-65/67 (Glutamate Decarboxylase 2, 65kD Glutamic acid Decarboxylase, GAD 65, Glutamate Decarboxylase 65kD Isoform, GAD2, GAD-65, GAD 2, GAD-2, Glutamate Decarboxylase 1, 67kD Glutamic acid Decarboxylase, GAD 67, Glutamate Decarboxylase 67kD Isoform, GAD1, GAD, GAD67, GAD-1, GAD 1)

Sign In for Pricing
View Details
GAD-65/67 (Glutamate Decarboxylase 2, 65kD Glutamic acid Decarboxylase, GAD 65, Glutamate Decarboxylase 65kD Isoform, GAD2, GAD-65, GAD 2, GAD-2, Glutamate Decarboxylase 1, 67kD Glutamic acid Decarboxylase, GAD 67, Glutamate Decarboxylase 67kD Isoform, GAD1, GAD, GAD67, GAD-1, GAD 1)
222842-02 100 µL

GAD-65/67 (Glutamate Decarboxylase 2, 65kD Glutamic acid Decarboxylase, GAD 65, Glutamate Decarboxylase 65kD Isoform, GAD2, GAD-65, GAD 2, GAD-2, Glutamate Decarboxylase 1, 67kD Glutamic acid Decarboxylase, GAD 67, Glutamate Decarboxylase 67kD Isoform, GAD1, GAD, GAD67, GAD-1, GAD 1)

Sign In for Pricing
View Details
ACD Peptide
orb2012262 100 µg

ACD Peptide

Sign In for Pricing
View Details