Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CACNA1I Rabbit Polyclonal Antibody (Biotin)

CACNA1I Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Cav3.3, ca (v) 3.3

UniProt

Q9P0X4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CACNA1I

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LRTDTGDTVPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMASTSPWAS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

245kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001003406

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lactoferrin Monoclonal Antibody, AbBy Fluor™ 680 Conjugated
bsm-41222M-BF680 100 µL

Lactoferrin Monoclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
Kallikrein 6 (KLK6) (NM_002774) Human Over-expression Lysate
LC400982 20 µg

Kallikrein 6 (KLK6) (NM_002774) Human Over-expression Lysate

Sign In for Pricing
View Details
TAG 4X18 3 STICKS YELLOW Rigid Wire and Panel Tags for Printers
4X18GI 1440 Pack (48 Label x 30 Card)

TAG 4X18 3 STICKS YELLOW Rigid Wire and Panel Tags for Printers

Sign In for Pricing
View Details
Cytokeratin 19 KRT19 Mouse Monoclonal Antibody (Fluoro647)
orb3084946 100 µg

Cytokeratin 19 KRT19 Mouse Monoclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
Bcl2 (9A4) Mouse Monoclonal Antibody
AMM03611-01 50 µL

Bcl2 (9A4) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Bcl2 (9A4) Mouse Monoclonal Antibody
AMM03611-02 100 µL

Bcl2 (9A4) Mouse Monoclonal Antibody

Sign In for Pricing
View Details