Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF12 Rabbit Polyclonal Antibody (FITC)

ZNF12 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

KOX3, HZF11, GIOT-3, ZNF325

UniProt

P17014

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF12

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: FLLQSYPDEVWQTDDLIERIQEEENKPSRQTVFIETLIEERGNVPGKTFD

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

IHC, WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse LECT1 (Leukocyte Cell Derived Chemotaxin 1) ELISA Kit
MBS8805092-01 48 Well

Mouse LECT1 (Leukocyte Cell Derived Chemotaxin 1) ELISA Kit

Sign In for Pricing
View Details
Mouse LECT1 (Leukocyte Cell Derived Chemotaxin 1) ELISA Kit
MBS8805092-02 96 Well

Mouse LECT1 (Leukocyte Cell Derived Chemotaxin 1) ELISA Kit

Sign In for Pricing
View Details
Mouse LECT1 (Leukocyte Cell Derived Chemotaxin 1) ELISA Kit
MBS8805092-03 5x 96 Well

Mouse LECT1 (Leukocyte Cell Derived Chemotaxin 1) ELISA Kit

Sign In for Pricing
View Details
Mouse LECT1 (Leukocyte Cell Derived Chemotaxin 1) ELISA Kit
MBS8805092-04 10x 96 Well

Mouse LECT1 (Leukocyte Cell Derived Chemotaxin 1) ELISA Kit

Sign In for Pricing
View Details
Ski oncogene (SKI) Mouse ELISA Kit
H1057 96 Tests

Ski oncogene (SKI) Mouse ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Card11 shRNA (UAS) - Lentiviral mouse Card11 shRNA (UAS) (100)
GTR15241134 1 Vial

Lentiviral mouse Card11 shRNA (UAS) - Lentiviral mouse Card11 shRNA (UAS) (100)

Sign In for Pricing
View Details