Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TDRD9 Rabbit Polyclonal Antibody (HRP)

TDRD9 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HLS, SPNE, HIG-1, NET54, SPGF30, C14orf75

UniProt

Q8NDG6

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human TDRD9

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PHPDLVCLAPFADFDKQRYFRAQVLYVSGNSAEVFFVDYGNKSHVDLHLL

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

152kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_694591

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KDM6B siRNA Oligos set (Human)
25487171 3x 5 nmol

KDM6B siRNA Oligos set (Human)

Sign In for Pricing
View Details
Amyloid Beta Peptide 1-42 (Ab1-42) Polyclonal Antibody
CAU31305-01 100 µL

Amyloid Beta Peptide 1-42 (Ab1-42) Polyclonal Antibody

Sign In for Pricing
View Details
Amyloid Beta Peptide 1-42 (Ab1-42) Polyclonal Antibody
CAU31305-02 200 µL

Amyloid Beta Peptide 1-42 (Ab1-42) Polyclonal Antibody

Sign In for Pricing
View Details
Amyloid Beta Peptide 1-42 (Ab1-42) Polyclonal Antibody
CAU31305-03 1 mL

Amyloid Beta Peptide 1-42 (Ab1-42) Polyclonal Antibody

Sign In for Pricing
View Details
Human/Mouse/Rat CCK-A R Affinity Purified Polyclonal Ab
AF2680-SP 25 µg

Human/Mouse/Rat CCK-A R Affinity Purified Polyclonal Ab

Sign In for Pricing
View Details
Cd63 (NM_001282966) Mouse Untagged Clone
MC226494 10 µg

Cd63 (NM_001282966) Mouse Untagged Clone

Sign In for Pricing
View Details