Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCM7 Rabbit Polyclonal Antibody (HRP)

MCM7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MCM2, CDC47, P85MCM, P1CDC47, PNAS146, PPP1R104, P1.1-MCM3

UniProt

P33993

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MCM7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MALKDYALEKEKVKKFLQEFYQDDELGKKQFKYGNQLVRLAHREQVALYV

Field of Research

Signal Transduction

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

AAH09398

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF275 Rabbit Polyclonal Antibody (HRP)
orb2110961 100 µL

ZNF275 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
NRG1 Human Over-expression Lysate
orb1347787 100 µg

NRG1 Human Over-expression Lysate

Sign In for Pricing
View Details
HIRIP3, ID (HIRIP3, HIRA-interacting protein 3) (MaxLight 405) discontinued
036574-ML405 100 µL

HIRIP3, ID (HIRIP3, HIRA-interacting protein 3) (MaxLight 405) discontinued

Sign In for Pricing
View Details
RPL31P10 3'UTR Luciferase Stable Cell Line
TU021290 1.0 mL

RPL31P10 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
4930444G20Rik 3'UTR Luciferase Stable Cell Line
TU100687 1.0 mL

4930444G20Rik 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
TNFSF9 (Tumor Necrosis Factor (Ligand) Superfamily, Member 9, 4-1BB-L, CD137L)
252852 100 µg

TNFSF9 (Tumor Necrosis Factor (Ligand) Superfamily, Member 9, 4-1BB-L, CD137L)

Sign In for Pricing
View Details