Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tcea2 Rabbit Polyclonal Antibody (HRP)

Tcea2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SII, S-II, Tcea, Tceat, SII-T1, S-II-T1, AI326274

UniProt

Q9QVN7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse Tcea2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KDASRTTDLSCKKPDPPRTPSTPRITTFPQVPITCDAVRNKCREMLTLAL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_033352

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Serpinb6b (NM_011454) Mouse Tagged ORF Clone Lentiviral Particle
MR205887L4V 200 µL

Serpinb6b (NM_011454) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
5-Chloro-2-(2-diethylaminoethylamino)-2'-fluorobenzophenone Hydrochloride
TRC-C366820-10MG 10 mg

5-Chloro-2-(2-diethylaminoethylamino)-2'-fluorobenzophenone Hydrochloride

Sign In for Pricing
View Details
Lentiviral human PGM5 shRNA (UAS) - Lentiviral human PGM5 shRNA (UAS, iRFP) (25)
GTR15086330 1 Vial

Lentiviral human PGM5 shRNA (UAS) - Lentiviral human PGM5 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Agaricus bisporus Lectin (ABA/ABL) - Pure
21510154-1 2 mg

Agaricus bisporus Lectin (ABA/ABL) - Pure

Sign In for Pricing
View Details
AMD1 (68-334, His-tag) Human Protein
AR50429PU-S 10 µg

AMD1 (68-334, His-tag) Human Protein

Sign In for Pricing
View Details
ICA 110381
4950/10 10 mg

ICA 110381

Sign In for Pricing
View Details