Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEBPD Rabbit Polyclonal Antibody (Biotin)

CEBPD Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CELF, CRP3, C/EBP-delta, NF-IL6-beta

UniProt

P49716

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CEBPD

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RNQEMQQKLVELSAENEKLHQRVEQLTRDLAGLRQFFKQLPSPPFLPAAG

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_005186

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHODL Antibody
orb1258532 100 µL

CHODL Antibody

Sign In for Pricing
View Details
Ift172 sgRNA CRISPR Lentivector set (Mouse)
K3492101 3x 1.0 µg

Ift172 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Sar1B CRISPR/Cas9 KO Plasmid (m)
sc-425994 20 µg

Sar1B CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
UvrB Antibody
orb835158 2 mg

UvrB Antibody

Sign In for Pricing
View Details
FBXO5, ID (FBXO5, EMI1, FBX5, F-box only protein 5, Early mitotic inhibitor 1) (PE)
MBS6298493-01 0.2 mL

FBXO5, ID (FBXO5, EMI1, FBX5, F-box only protein 5, Early mitotic inhibitor 1) (PE)

Sign In for Pricing
View Details
FBXO5, ID (FBXO5, EMI1, FBX5, F-box only protein 5, Early mitotic inhibitor 1) (PE)
MBS6298493-02 5x 0.2 mL

FBXO5, ID (FBXO5, EMI1, FBX5, F-box only protein 5, Early mitotic inhibitor 1) (PE)

Sign In for Pricing
View Details