Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hmg20b Rabbit Polyclonal Antibody (Biotin)

Hmg20b Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

D4A586

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TKMLGAEWSKLQPAEKQRYLDEAEKEKQQYLKELWAYQQSEAYKVCTEKI

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001102201

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF491 Rabbit Polyclonal Antibody (FITC)
orb2132269 100 µL

ZNF491 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
CADM1, NT (CADM1, IGSF4, IGSF4A, NECL2, SYNCAM, TSLC1, Cell adhesion molecule 1, Immunoglobulin superfamily member 4, Nectin-like protein 2, Spermatogenic immunoglobulin superfamily, Synaptic cell adhesion molecule, Tumor suppressor in lung cancer 1) (Azide free) (HRP)
033140-HRP 200 µL

CADM1, NT (CADM1, IGSF4, IGSF4A, NECL2, SYNCAM, TSLC1, Cell adhesion molecule 1, Immunoglobulin superfamily member 4, Nectin-like protein 2, Spermatogenic immunoglobulin superfamily, Synaptic cell adhesion molecule, Tumor suppressor in lung cancer 1) (Azide free) (HRP)

Sign In for Pricing
View Details
LRRC2 Rabbit Polyclonal Antibody (Cy3)
orb990631 100 µL

LRRC2 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
GDF-3 Polyclonal Antibody
JOT-AP03529-01 20 µL

GDF-3 Polyclonal Antibody

Sign In for Pricing
View Details
GDF-3 Polyclonal Antibody
JOT-AP03529-02 50 μL

GDF-3 Polyclonal Antibody

Sign In for Pricing
View Details
GDF-3 Polyclonal Antibody
JOT-AP03529-03 100 µL

GDF-3 Polyclonal Antibody

Sign In for Pricing
View Details