Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SSX3 Rabbit Polyclonal Antibody (HRP)

SSX3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CT5.3

UniProt

Q7RTT3

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SSX3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LCPPGKPTTSEKINMISGPKRGEHAWTHRLRERKQLVIYEEISDPEEDDE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_066294

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARMC12 Protein Vector (Human) (pPM-N-D-C-His)
PV323809 500 ng

ARMC12 Protein Vector (Human) (pPM-N-D-C-His)

Sign In for Pricing
View Details
SERPINA3 (Alpha-1-antichymotrypsin, ACT, Cell Growth-inhibiting Gene 24/25 Protein, Serpin A3, AACT, GIG24, GIG25) (MaxLight 650)
133161-ML650 100 µL

SERPINA3 (Alpha-1-antichymotrypsin, ACT, Cell Growth-inhibiting Gene 24/25 Protein, Serpin A3, AACT, GIG24, GIG25) (MaxLight 650)

Sign In for Pricing
View Details
Mouse Proteasome Assembly Chaperone 2 (PSMG2) Antibody Pair Kit (with Standard)
MBS2102879-01 5x 96 Tests

Mouse Proteasome Assembly Chaperone 2 (PSMG2) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Proteasome Assembly Chaperone 2 (PSMG2) Antibody Pair Kit (with Standard)
MBS2102879-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Mouse Proteasome Assembly Chaperone 2 (PSMG2) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Proteasome Assembly Chaperone 2 (PSMG2) Antibody Pair Kit (with Standard)
MBS2102879-03 10x 96 Tests

Mouse Proteasome Assembly Chaperone 2 (PSMG2) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Proteasome Assembly Chaperone 2 (PSMG2) Antibody Pair Kit (with Standard)
MBS2102879-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Mouse Proteasome Assembly Chaperone 2 (PSMG2) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details