Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF8 Rabbit Polyclonal Antibody (HRP)

ZNF8 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HF.18, Zfp128

UniProt

P17098

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF8

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MDPEDEGVAGVMSVGPPAARLQEPVTFRDVAVDFTQEEWGQLDPTQRILY

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

65kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_066575

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myristoylated ARF6 (2-13), scrambled
HY-P10186 1 Each

Myristoylated ARF6 (2-13), scrambled

Sign In for Pricing
View Details
Goat B-Cell CLL/Lymphoma 9 ELISA Kit
MBS052338 Inquire

Goat B-Cell CLL/Lymphoma 9 ELISA Kit

Sign In for Pricing
View Details
Rabbit anti-human inositol polyphosphate-5-phosphatase J polyclonal Antibody
MBS714422-01 0.1 mL

Rabbit anti-human inositol polyphosphate-5-phosphatase J polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-human inositol polyphosphate-5-phosphatase J polyclonal Antibody
MBS714422-02 5x 0.1 mL

Rabbit anti-human inositol polyphosphate-5-phosphatase J polyclonal Antibody

Sign In for Pricing
View Details
B7-H6/NCR3LG1, His, Cynomolgus
Z04742-500 500 µg

B7-H6/NCR3LG1, His, Cynomolgus

Sign In for Pricing
View Details
ASCC2 (Activating Signal Cointegrator 1 Complex Subunit 2, ASC-1 Complex Subunit p100, Trip4 Complex Subunit p100, ASC1P100)
123610 50 µg

ASCC2 (Activating Signal Cointegrator 1 Complex Subunit 2, ASC-1 Complex Subunit p100, Trip4 Complex Subunit p100, ASC1P100)

Sign In for Pricing
View Details