Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF410 Rabbit Polyclonal Antibody (HRP)

ZNF410 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

APA1, APA-1

UniProt

Q86VK4

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ZN410

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GSPRSLSSVPDVTHHLVTMQSGRQSYEVSVLTAVNPQELLNQGDLTERRT

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD31 / PECAM-1 (Endothelial Cell Marker) (PECAM1/3530), CF640R conjugate, 0.1mg/mL
BNC403530-500 1x 500 µL

CD31 / PECAM-1 (Endothelial Cell Marker) (PECAM1/3530), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human S100A11 (S100 Calcium Binding Protein A11) CLIA Kit
E-CL-H0843-01 24 Tests

Human S100A11 (S100 Calcium Binding Protein A11) CLIA Kit

Sign In for Pricing
View Details
Human S100A11 (S100 Calcium Binding Protein A11) CLIA Kit
E-CL-H0843-02 48 Tests

Human S100A11 (S100 Calcium Binding Protein A11) CLIA Kit

Sign In for Pricing
View Details
Human S100A11 (S100 Calcium Binding Protein A11) CLIA Kit
E-CL-H0843-03 96 Tests

Human S100A11 (S100 Calcium Binding Protein A11) CLIA Kit

Sign In for Pricing
View Details
TASP1 (NM_017714) Human Over-expression Lysate
LC402609 20 µg

TASP1 (NM_017714) Human Over-expression Lysate

Sign In for Pricing
View Details
CD5 Mouse Monoclonal Antibody [Clone ID: 1H6/8]
AM05559FC-N 100 µg

CD5 Mouse Monoclonal Antibody [Clone ID: 1H6/8]

Sign In for Pricing
View Details