Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRDM13 Rabbit Polyclonal Antibody (HRP)

PRDM13 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PFM10, MU-MB-20.220

UniProt

Q5TGC2

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PRDM13

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HGAARAPATSVSADCCIPAGLRLGPVPGTFKLGKYLSDRREPGPKKKVRM

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

74kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_067633

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL9P19 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV776029 1.0 µg DNA

RPL9P19 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Rab31 Antibody
orb334989 100 µg

Rab31 Antibody

Sign In for Pricing
View Details
GNB1L Rabbit Polyclonal Antibody
TA359641 100 µL

GNB1L Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human IGF2 Antibody , PerCP
E55A09023 50 Tests

Human IGF2 Antibody , PerCP

Sign In for Pricing
View Details
Recombinant Escherichia coli IMPACT family member yigZ (yigZ)
MBS1234079-01 0.02 mg (E-Coli)

Recombinant Escherichia coli IMPACT family member yigZ (yigZ)

Sign In for Pricing
View Details
Recombinant Escherichia coli IMPACT family member yigZ (yigZ)
MBS1234079-02 0.1 mg (E-Coli)

Recombinant Escherichia coli IMPACT family member yigZ (yigZ)

Sign In for Pricing
View Details