Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRDM13 Rabbit Polyclonal Antibody (FITC)

PRDM13 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

PFM10, MU-MB-20.220

UniProt

Q9H4Q3

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human PRDM13

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SLLAKAGDGPGAEPGYPPEPGDPKSDDSDVDVCFTDDQSDPEVGGGGERD

Field of Research

Signal Transduction

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

75kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_067633

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Acot7 ORF Vector (Mouse) (pORF)
ORF037954 1.0 µg DNA

Acot7 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Gradient Mixer, total volume 50ml
CSL-GM50 50 m L

Gradient Mixer, total volume 50ml

Sign In for Pricing
View Details
DUSP7 (Dual Specificity Protein Phosphatase 7, Dual Specificity Protein Phosphatase PYST2, PYST2) (PE)
MBS6376743-01 0.1 mL

DUSP7 (Dual Specificity Protein Phosphatase 7, Dual Specificity Protein Phosphatase PYST2, PYST2) (PE)

Sign In for Pricing
View Details
DUSP7 (Dual Specificity Protein Phosphatase 7, Dual Specificity Protein Phosphatase PYST2, PYST2) (PE)
MBS6376743-02 5x 0.1 mL

DUSP7 (Dual Specificity Protein Phosphatase 7, Dual Specificity Protein Phosphatase PYST2, PYST2) (PE)

Sign In for Pricing
View Details
Recombinant Neisseria meningitidis serogroup A / serotype 4A Hydroxyacylglutathione hydrolase (gloB)
MBS1066313-01 0.02 mg (E-Coli)

Recombinant Neisseria meningitidis serogroup A / serotype 4A Hydroxyacylglutathione hydrolase (gloB)

Sign In for Pricing
View Details
Recombinant Neisseria meningitidis serogroup A / serotype 4A Hydroxyacylglutathione hydrolase (gloB)
MBS1066313-02 0.1 mg (E-Coli)

Recombinant Neisseria meningitidis serogroup A / serotype 4A Hydroxyacylglutathione hydrolase (gloB)

Sign In for Pricing
View Details