Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRDM13 Rabbit Polyclonal Antibody (HRP)

PRDM13 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PFM10, MU-MB-20.220

UniProt

Q9H4Q3

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human PRDM13

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SLLAKAGDGPGAEPGYPPEPGDPKSDDSDVDVCFTDDQSDPEVGGGGERD

Field of Research

Signal Transduction

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

75kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_067633

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

LILRA3 Mouse mAb
E2222849 100 µL

LILRA3 Mouse mAb

Sign In for Pricing
View Details
Xpert Carba-R QC Panel M219
M219 12x 50 µL

Xpert Carba-R QC Panel M219

Sign In for Pricing
View Details
EIF2AK2 (PKR) Polyclonal Antibody
bs-1493R-TR 20 µL

EIF2AK2 (PKR) Polyclonal Antibody

Sign In for Pricing
View Details
MegaFLUO® CHLAM felis
716K10FK1 1 Kit

MegaFLUO® CHLAM felis

Sign In for Pricing
View Details
SERPINA4 Antibody
orb2673833-01 50 µL

SERPINA4 Antibody

Sign In for Pricing
View Details
SERPINA4 Antibody
orb2673833-02 100 µL

SERPINA4 Antibody

Sign In for Pricing
View Details