Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FOXA2 Rabbit Polyclonal Antibody (Biotin)

FOXA2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HNF3B, TCF3B, HNF-3-beta

UniProt

Q9Y261

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human FOXA2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MLGAVKMEGHEPSDWSSYYAEPEGYSSVSNMNAGLGMNGMNTYMSMSAAA

Field of Research

Epigenetics & Chromatin

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_710141

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human SLC22A24 shRNA (UAS) - Lentiviral human SLC22A24 shRNA (UAS) (25)
GTR15343508 1 Vial

Lentiviral human SLC22A24 shRNA (UAS) - Lentiviral human SLC22A24 shRNA (UAS) (25)

Sign In for Pricing
View Details
Chmp1a 3'UTR Luciferase Stable Cell Line
TU202291 1.0 mL

Chmp1a 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
TMCO5B, CT (TMCO5B, Transmembrane and coiled-coil domain-containing protein 5B) (APC)
MBS6356197-01 0.2 mL

TMCO5B, CT (TMCO5B, Transmembrane and coiled-coil domain-containing protein 5B) (APC)

Sign In for Pricing
View Details
TMCO5B, CT (TMCO5B, Transmembrane and coiled-coil domain-containing protein 5B) (APC)
MBS6356197-02 5x 0.2 mL

TMCO5B, CT (TMCO5B, Transmembrane and coiled-coil domain-containing protein 5B) (APC)

Sign In for Pricing
View Details
Recombinant Human PVRL1/NECTIN1/CD111 protein (His tag)
PDMH100133-01 20 µg

Recombinant Human PVRL1/NECTIN1/CD111 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human PVRL1/NECTIN1/CD111 protein (His tag)
PDMH100133-02 100 µg

Recombinant Human PVRL1/NECTIN1/CD111 protein (His tag)

Sign In for Pricing
View Details