Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FOXA2 Rabbit Polyclonal Antibody (Biotin)

FOXA2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HNF3B, TCF3B, HNF-3-beta

UniProt

Q9Y261

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human FOXA2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QVMHYPGYGSPMPGSLAMGPVTNKTGLDASPLAADTSYYQGVYSRPIMNS

Field of Research

Epigenetics & Chromatin

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_068556

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human BTBD10 shRNA (UAS) - Lentiviral human BTBD10 shRNA (UAS, RFP) plasmid
GTR15320260 1 Vial

Lentiviral human BTBD10 shRNA (UAS) - Lentiviral human BTBD10 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
AHA1/AHSA1 Rabbit Polyclonal Antibody (Carrier-free)
orb3103124 100 µg

AHA1/AHSA1 Rabbit Polyclonal Antibody (Carrier-free)

Sign In for Pricing
View Details
Anti-JAK3  (3F10)
YF-MA13897 100 ug

Anti-JAK3 (3F10)

Sign In for Pricing
View Details
Human Complement C3 Convertase (C3 Convertase) High Sensitive ELISA Kit
MBS2708028-01 24 Strip Well

Human Complement C3 Convertase (C3 Convertase) High Sensitive ELISA Kit

Sign In for Pricing
View Details
Human Complement C3 Convertase (C3 Convertase) High Sensitive ELISA Kit
MBS2708028-02 48 Well

Human Complement C3 Convertase (C3 Convertase) High Sensitive ELISA Kit

Sign In for Pricing
View Details
Human Complement C3 Convertase (C3 Convertase) High Sensitive ELISA Kit
MBS2708028-03 96 Well

Human Complement C3 Convertase (C3 Convertase) High Sensitive ELISA Kit

Sign In for Pricing
View Details