Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FOXA2 Rabbit Polyclonal Antibody (FITC)

FOXA2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HNF3B, TCF3B, HNF-3-beta

UniProt

Q9Y261

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human FOXA2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QVMHYPGYGSPMPGSLAMGPVTNKTGLDASPLAADTSYYQGVYSRPIMNS

Field of Research

Epigenetics & Chromatin

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_068556

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

TrkB / NTRK2 Polyclonal Antibody
ANT-14879-100ug 100 µg

TrkB / NTRK2 Polyclonal Antibody

Sign In for Pricing
View Details
Mouse BAZ1B shRNA Plasmid
abx973391-01 150 µg

Mouse BAZ1B shRNA Plasmid

Sign In for Pricing
View Details
Mouse BAZ1B shRNA Plasmid
abx973391-02 300 µg

Mouse BAZ1B shRNA Plasmid

Sign In for Pricing
View Details
Magic™ Human EGFR (L858R) BaF3 Cell Line
S01YF-1222-KX857 1 Vial

Magic™ Human EGFR (L858R) BaF3 Cell Line

Sign In for Pricing
View Details
ACTN4 Polyclonal Antibody
E916310 100 µL

ACTN4 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human C-C Motif Chemokine 24/CCL24/Eotaxin-2/MPIF-2 Protein (C-6His)
E53A05207 50 µg

Recombinant Human C-C Motif Chemokine 24/CCL24/Eotaxin-2/MPIF-2 Protein (C-6His)

Sign In for Pricing
View Details