Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF70 Rabbit Polyclonal Antibody (HRP)

ZNF70 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Cos17

UniProt

Q9UC06

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF70

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GKAFRHRSALIEHYKTHTREKPYVCNLCGKSFRGSSHLIRHQKIHSGEKL

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_068735

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Arp3/ACTR3 Antibody Picoband®, Carrier-free
A03423-2-carrier-free 100 µg/Vial

Anti-Arp3/ACTR3 Antibody Picoband®, Carrier-free

Sign In for Pricing
View Details
Lentiviral human MTRNR2L8 sgRNA gene knockout kit - Lentiviral human MTRNR2L8 sgRNA gene knockout kit (plasmid)
GTR15367841 1 Vial

Lentiviral human MTRNR2L8 sgRNA gene knockout kit - Lentiviral human MTRNR2L8 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
SLC38A9 Recombinant Protein (Human)
RP043492 100 µg

SLC38A9 Recombinant Protein (Human)

Sign In for Pricing
View Details
Human RBIS Pre-designed siRNA Set B
SI013485B 1 Each

Human RBIS Pre-designed siRNA Set B

Sign In for Pricing
View Details
SCYL1BP1 Rabbit Polyclonal Antibody (HRP)
orb480773 100 µL

SCYL1BP1 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
CADPS2 3'UTR GFP Stable Cell Line
TU053387 1.0 mL

CADPS2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details